Nechat relaci otevřenou?
Ukončení za 
Relace skončila
Vaše relace vypršela. Pro vaši bezpečnost jsme vás odhlásili.
Chcete se opět přihlásit?

Anti-SORD Mouse Monoclonal Antibody [clone: 4D3]

Dodavatel: US Biological
Recommended dilution: Immunochemistry: 1. 2μg/ml

Type: Primary
Antigen: SORD (sorbitol dehydrogenase)
Clonality: monoclonal
Clone: 4D3
Conjugation: unconjugated
Epitope:
Host: Mouse
Isotype: IgG1 Kappa
Reactivity: Human, Mouse, Rat



Po přihlášení uvidíte dostupnost zboží na skladě a ceny.
  Zapamatovat si mě na tomto zařízení
 

OBJEDNÁVKA

Rozbalit vše / Zavřít vše
Rozměry protilátky Bal. VWR katalogové číslo Množství
100 µg 100 µG USBI133708
Generovat čárové kódy Formát popisku čárového kódu : 
Vygenerovat PDF katalog

Produktová specifikace

Symbol antigenu SORD
Název antigenu sorbitol dehydrogenase
Reaktivita Human, Mouse, Rat
Spojení Unconjugated
Klonovalita Monoclonal
Druh protilátky Primary
Klon 4D3
Hostitel Mouse
Isotyp IgG1 kappa
Western blot Yes
ELISA Yes
Počet aminokyselin 1 to 111
Čištění purified by Protein A chromatography
Sekvence MAAAAKPNNLSLVVHGPGDLRLENYPIPEPGPNEVLLRMHSVGICGSDVHYWEYGRIGNFIVKKPMVLGHEASGTVEKVGSSVKHLKPGDRVAIEPGAPRENDEFCKMGR*
Forma liquid
Skladovací pufr PBS, pH 7,2.
Skladovací teplota Cool
Transportní teplota Ice
Enter Details

Select the article for which you are looking for Certificate

Doplňte Lot číslo. Toto pole je povinné. Jestli číslo neznáte, napíšte "x".

Enter Certificate Details

Enter the Lot number:

Choose from recent batch/lot numbers:

Nebo
Review & Compare Alternatives
We found alternative products that can save you up to  per item-unit.  To compare product details, select up to 3 alternatives below and click Compare Selected. To add items to your basket, enter a quantity and click Add to Basket.

Original Product:

Popis Katalogové číslo Availability Jednotka Vaše cena Price Per Množství