Nechat relaci otevřenou?
Ukončení za 
Relace skončila
Vaše relace vypršela. Pro vaši bezpečnost jsme vás odhlásili.
Chcete se opět přihlásit?

Anti-SP140 Mouse Monoclonal Antibody [clone: 3F9]

Dodavatel: US Biological
Recommended dilution: Immunochemistry: 1. 5 μg/ml

Type: Primary
Antigen: SP140 (SP140 nuclear body protein)
Clonality: monoclonal
Clone: 3F9
Conjugation: unconjugated
Epitope:
Host: Mouse
Isotype: IgG2a Kappa
Reactivity: Human




 

OBJEDNÁVKA

Rozbalit vše / Zavřít vše
Rozměry protilátky Bal. VWR katalogové číslo Množství
100 µg 100 µG USBI133734
Generovat čárové kódy Formát popisku čárového kódu : 
Vygenerovat PDF katalog

Produktová specifikace

Symbol antigenu SP140
Název antigenu SP140 nuclear body Protein
Reaktivita Human
Spojení Unconjugated
Klonovalita Monoclonal
Druh protilátky Primary
Klon 3F9
Hostitel Mouse
Isotyp IgG2a kappa
ELISA Yes
Počet aminokyselin 504 to 613
Čištění purified by Protein A chromatography
Sekvence GHGWSRMRMRRQKNSQQNDNSKADGQVVSSEKKANVNLKDLSKIRGRKRGKPGTRFTQSDRAAQKRVRSRASRKHKDETVDFKAPLLPVTCGGVKGILHKKKLQQGILV*
Forma liquid
Skladovací pufr PBS, pH 7,2.
Skladovací teplota Cool
Transportní teplota Ice
Enter Details

Select the article for which you are looking for Certificate

Doplňte Lot číslo. Toto pole je povinné. Jestli číslo neznáte, napíšte "x".

Enter Certificate Details

Enter the Lot number:

Choose from recent batch/lot numbers:

Nebo
Review & Compare Alternatives
We found alternative products that can save you up to  per item-unit.  To compare product details, select up to 3 alternatives below and click Compare Selected. To add items to your basket, enter a quantity and click Add to Basket.

Original Product:

Popis Katalogové číslo Availability Jednotka Vaše cena Price Per Množství
 

Nový vzhled a obnovený závazek

Vytvořen na základě funkcí a zdrojů, které znáte, a optimalizovaný díky inovacím od Avantoru®. Naše nová značka symbolizuje rychlost reakcí a naši schopnost přizpůsobit se potřebám zákazníků.

PODROBNĚJŠÍ INFORMACE ZAČÍT NAKUPOVAT