Nechat relaci otevřenou?
Ukončení za 
Relace skončila
Vaše relace vypršela. Pro vaši bezpečnost jsme vás odhlásili.
Chcete se opět přihlásit?

Anti-SP3 Mouse Monoclonal Antibody [clone: 3H7]

Dodavatel: US Biological
Recommended dilution: Immunofluorescence: 10 μg/ml

Type: Primary
Antigen: SP3 (Sp3 transcription factor)
Clonality: monoclonal
Clone: 3H7
Conjugation: unconjugated
Epitope:
Host: Mouse
Isotype: IgG2b Kappa
Reactivity: Human




 

OBJEDNÁVKA

Rozbalit vše / Zavřít vše
Rozměry protilátky Bal. VWR katalogové číslo Množství
100 µg 100 µG USBI133736
Generovat čárové kódy Formát popisku čárového kódu : 
Vygenerovat PDF katalog

Produktová specifikace

Symbol antigenu SP3
Název antigenu Sp3 transcription factor
Reaktivita Human
Spojení Unconjugated
Klonovalita Monoclonal
Druh protilátky Primary
Klon 3H7
Hostitel Mouse
Isotyp IgG2b kappa
Western blot Yes
ELISA Yes
Imunofluorescence Yes
Počet aminokyselin 516 to 616
Čištění purified by Protein A chromatography
Sekvence GQLPNLQTVTVNSIDSAGIQLHPGENADSPADIRIKEEEPDPEEWQLSGDSTLNTNDLTHLRVQVVDEEGDQQHQEGKRLRRVACTCPNCKEGGGRGTNL*
Forma liquid
Skladovací pufr PBS, pH 7,2.
Skladovací teplota Cool
Transportní teplota Ice
Enter Details

Select the article for which you are looking for Certificate

Doplňte Lot číslo. Toto pole je povinné. Jestli číslo neznáte, napíšte "x".

Enter Certificate Details

Enter the Lot number:

Choose from recent batch/lot numbers:

Nebo
Review & Compare Alternatives
We found alternative products that can save you up to  per item-unit.  To compare product details, select up to 3 alternatives below and click Compare Selected. To add items to your basket, enter a quantity and click Add to Basket.

Original Product:

Popis Katalogové číslo Availability Jednotka Vaše cena Price Per Množství
 

Nový vzhled a obnovený závazek

Vytvořen na základě funkcí a zdrojů, které znáte, a optimalizovaný díky inovacím od Avantoru®. Naše nová značka symbolizuje rychlost reakcí a naši schopnost přizpůsobit se potřebám zákazníků.

PODROBNĚJŠÍ INFORMACE ZAČÍT NAKUPOVAT