Nechat relaci otevřenou?
Ukončení za 
Relace skončila
Vaše relace vypršela. Pro vaši bezpečnost jsme vás odhlásili.
Chcete se opět přihlásit?

Anti-SPN Rabbit Polyclonal Antibody

Dodavatel: US Biological
Type: Primary
Antigen: SPN (sialophorin)
Clonality: polyclonal
Clone:
Conjugation: unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human




 

OBJEDNÁVKA

Rozbalit vše / Zavřít vše
Rozměry protilátky Bal. VWR katalogové číslo Množství
100 µg 100 µG USBI133782
Generovat čárové kódy Formát popisku čárového kódu : 
Vygenerovat PDF katalog

Produktová specifikace

Symbol antigenu SPN
Název antigenu Sialophorin
Reaktivita Human
Spojení Unconjugated
Klonovalita Polyclonal
Druh protilátky Primary
Hostitel Rabbit
Isotyp IgG
Western blot Yes
Počet aminokyselin 1 to 400
Čištění purified by Protein A chromatography
Sekvence MATLLLLLGVLVVSPDALGSTTAVQTPTSGEPLVSTSEPLSSKMYTTSITSDPKADSTGDQTSALPPSTSINEGSPLWTSIGASTGSPLPEPTTYQEVSIKMSSVPQETPHATSHPAVPITANSLGSHTVTGGTITTNSPETSSRTSGAPVTTAASSLETSRGTSGPPLTMATVSLETSKGTSGPPVTMATDSLETSTGTTGPPVTMTTGSLEPSSGASGPQVSSVKLSTMMSPTTSTNASTVPFRNPDENSRGMLPVAVLVALLAVIVLVALLLLWRRRQKRRTGALVLSRGGKRNGVVDAWAGPAQVPEEGAVTVTVGGSGGDKGSGFPDGEGSSRRPTLTTFFGRRKSRQGSLAMEELKSGSGPSLKGEEEPLVASEDGAVDAPAPDEPEGGDGAAP
Forma liquid
Skladovací pufr PBS, pH 7,2.
Skladovací teplota Cool
Transportní teplota Ice
Enter Details

Select the article for which you are looking for Certificate

Doplňte Lot číslo. Toto pole je povinné. Jestli číslo neznáte, napíšte "x".

Enter Certificate Details

Enter the Lot number:

Choose from recent batch/lot numbers:

Nebo
Review & Compare Alternatives
We found alternative products that can save you up to  per item-unit.  To compare product details, select up to 3 alternatives below and click Compare Selected. To add items to your basket, enter a quantity and click Add to Basket.

Original Product:

Popis Katalogové číslo Availability Jednotka Vaše cena Price Per Množství
 

Nový vzhled a obnovený závazek

Vytvořen na základě funkcí a zdrojů, které znáte, a optimalizovaný díky inovacím od Avantoru®. Naše nová značka symbolizuje rychlost reakcí a naši schopnost přizpůsobit se potřebám zákazníků.

PODROBNĚJŠÍ INFORMACE ZAČÍT NAKUPOVAT