Nechat relaci otevřenou?
Ukončení za 
Relace skončila
Vaše relace vypršela. Pro vaši bezpečnost jsme vás odhlásili.
Chcete se opět přihlásit?

Anti-ARHGAP25 Mouse Monoclonal Antibody

Dodavatel: Abnova
Mouse monoclonal antibody raised against a full-length recombinant ARHGAP25.

Type: Primary
Antigen: ARHGAP25
Clonality: Monoclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype:
Reactivity: Human



Po přihlášení uvidíte dostupnost zboží na skladě a ceny.
  Zapamatovat si mě na tomto zařízení
 

OBJEDNÁVKA

Rozbalit vše / Zavřít vše
Rozměry protilátky Bal. VWR katalogové číslo Množství
Up to 5 Clones 1 ABNOH00009938-M
Generovat čárové kódy Formát popisku čárového kódu : 
Vygenerovat PDF katalog

TECHNICKÉ ÚDAJE

Symbol antigenu ARHGAP25
Název antigenu Rho GTPase activating protein 25
Reaktivita Human
Spojení Unconjugated
Klonovalita Monoclonal
Druh protilátky Primary
Hostitel Mouse
Western Blot Yes
ELISA Yes
Synonyma antigenu HEL-S-308, KAIA0053
Počet aminokyselin 1 to 458
Gene ID 9938
Formát Liquid
Křížová adsorbce No
Imunogen ARHGAP25 (AAH39591.1, 1 a.a. ~ 458 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sekvence MSLGQSACLFLSIARSRSVMTGEQMAAFHPSSTPNPLERPIKMGWLKKQRSIVKNWQQRYFVLRAQQLYYYKDEEDTKPQGCMYLPGCTIKEIATNPEEAGKFVFEIIPASWDQNRMGQDSYVLMASSQAEMEEWVKFLRRVAGTPCGAVFGQRLDETVAYEQKFGPHLVPILVEKCAEFILEHGRNEEGIFRLPGQDNLVKQLRDAFDAGERPSFDRDTDVHTVASLLKLYLRDLPEPVVPWSQYEGFLLCGQLTNADEAKAQQELMKQLSILPRDNYSLLSYICRFLHEIQLNCAVNKMSVDNLATVIGVNLIRSKVEDPAVIMRGTPQIQRVMTMMIRDHEVLFPKSKDIPLSPPAQKNDPKKAPVARSSVGWDATEDLRISRTDSFSSMVRCREPSCFHWVLPLVQAIPCKACSRVAIWGVLGDAVAVGAAATDSSEHTLKAWPLSKSSFYWHL
Enter Details

Select the article for which you are looking for Certificate

Doplňte Lot číslo. Toto pole je povinné. Jestli číslo neznáte, napíšte "x".

Enter Certificate Details

Vyberte produkt:

Enter the Lot number:

Choose from recent batch/lot numbers:

Nebo
Review & Compare Alternatives
We found alternative products that can save you up to  per item-unit.  To compare product details, select up to 3 alternatives below and click Compare Selected. To add items to your basket, enter a quantity and click Add to Basket.

Original Product:

Popis Katalogové číslo Availability Jednotka Vaše cena Price Per Množství