Nechat relaci otevřenou?
Ukončení za 
Relace skončila
Vaše relace vypršela. Pro vaši bezpečnost jsme vás odhlásili.
Chcete se opět přihlásit?

Anti-BZW1 Mouse Monoclonal Antibody

Dodavatel: Abnova
Mouse monoclonal antibody raised against a full-length recombinant BZW1.

Type: Primary
Antigen: BZW1
Clonality: Monoclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype:
Reactivity: Human




 

OBJEDNÁVKA

Rozbalit vše / Zavřít vše
Rozměry protilátky Bal. VWR katalogové číslo Množství
Up to 5 Clones 1 ABNOH00009689-M
Generovat čárové kódy Formát popisku čárového kódu : 
Vygenerovat PDF katalog

Produktová specifikace

Symbol antigenu BZW1
Název antigenu basic leucine zipper and W2 domains 1
Reaktivita Human
Spojení Unconjugated
Klonovalita Monoclonal
Druh protilátky Primary
Hostitel Mouse
Western blot Yes
ELISA Yes
Synonyma antigenu BZAP45, Nbla10236
Počet aminokyselin 1 to 353
Identifikační číslo genu 9689
Formát Liquid
Křížová adsorbce No
Imunogen BZW1 (NP_055485.2, 1 a.a. ~ 353 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sekvence MNNQKQQKPTLSGQRFKTRKRDEKERFDPTQFQDCIIQGLTETGTDLEAVAKFLDASGAKLDYRRYAETLFDILVAGGMLAPGGTLADDMMRTDVCVFAAQEDLETMQAFAQVFNKLIRRYKYLEKGFEDEVKKLLLFLKGFSESERNKLAMLTGVLLANGTLNASILNSLYNENLVKEGVSAAFAVKLFKSWINEKDINAVAASLRKVSMDNRLMELFPANKQSVEHFTKYFTEAGLKELSEYVRNQQTIGARKELQKELQEQMSRGDPFKDIILYVKEEMKKNNIHFMKAFQKIVVLFYKAEVLSEEPILKWYKDAHVAKGKSVFLEQMKKFVEWLKNAEEESESEAEEGD
Enter Details

Select the article for which you are looking for Certificate

Doplňte Lot číslo. Toto pole je povinné. Jestli číslo neznáte, napíšte "x".

Enter Certificate Details

Enter the Lot number:

Choose from recent batch/lot numbers:

Nebo
Review & Compare Alternatives
We found alternative products that can save you up to  per item-unit.  To compare product details, select up to 3 alternatives below and click Compare Selected. To add items to your basket, enter a quantity and click Add to Basket.

Original Product:

Popis Katalogové číslo Availability Jednotka Vaše cena Price Per Množství