Nechat relaci otevřenou?
Ukončení za 
Relace skončila
Vaše relace vypršela. Pro vaši bezpečnost jsme vás odhlásili.
Chcete se opět přihlásit?

Anti-FAM162A Rabbit Polyclonal Antibody

Dodavatel: Abnova
Rabbit polyclonal antibody raised against recombinant FAM162A.

Recommended Dilutions: Immunohistochemistry: 1:20-1:50; Western Blot: 1:250-1:500

Type: Primary
Antigen: FAM162A
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human



 

OBJEDNÁVKA

Rozbalit vše / Zavřít vše
Rozměry protilátky Bal. VWR katalogové číslo Množství
100 μl 100 µl ABNOPAB22720
Generovat čárové kódy Formát popisku čárového kódu : 
Vygenerovat PDF katalog

Produktová specifikace

Symbol antigenu FAM162A
Název antigenu Family with sequence similarity 162, member A
Reaktivita Human
Spojení Unconjugated
Klonovalita Polyclonal
Druh protilátky Primary
Hostitel Rabbit
Isotyp IgG
Western blot Yes
Imunochemie Yes
Synonyma antigenu C3orf28, E2IG5, HGTD-P
Identifikační číslo genu 26355
Formát Liquid
Křížová adsorbce No
Imunogen Recombinant protein corresponding to amino acids of human FAM162A.
Čištění Antigen affinity purification
Sekvence SSSLRLTRSSDLKRINGFCTKPQESPGAPSRTYNRVPLHKPTDWQKKILIWSGRFKKEDEIPETVSLEMLDAAKNKMRV
Skladovací pufr PBS, pH 7,5 (40% glycerol, 0,02% sodium azide)
Skladovací teplota Store at 4 °C. For long term storage store at – 20 °C. Aliquot to avoid repeated freezing and thawing.
Enter Details

Select the article for which you are looking for Certificate

Doplňte Lot číslo. Toto pole je povinné. Jestli číslo neznáte, napíšte "x".

Enter Certificate Details

Enter the Lot number:

Choose from recent batch/lot numbers:

Nebo
Review & Compare Alternatives
We found alternative products that can save you up to  per item-unit.  To compare product details, select up to 3 alternatives below and click Compare Selected. To add items to your basket, enter a quantity and click Add to Basket.

Original Product:

Popis Katalogové číslo Availability Jednotka Vaše cena Price Per Množství
 

Nový vzhled a obnovený závazek

Vytvořen na základě funkcí a zdrojů, které znáte, a optimalizovaný díky inovacím od Avantoru®. Naše nová značka symbolizuje rychlost reakcí a naši schopnost přizpůsobit se potřebám zákazníků.

PODROBNĚJŠÍ INFORMACE ZAČÍT NAKUPOVAT