|
|
OBJEDNÁVKA
Produktová specifikace
Symbol antigenu | PRRT3 |
Název antigenu | Proline-rich Transmembrane Protein 3 |
Reaktivita | Human |
Spojení | Unconjugated |
Klonovalita | Polyclonal |
Druh protilátky | Primary |
Hostitel | Rabbit |
Isotyp | IgG |
Western blot | Yes |
ImmunoChemistry | Yes |
Gene ID | 285368 |
Formát | Liquid |
Křížová adsorbce | No |
Imunogen | Recombinant protein corresponding to amino acids of human PRRT3. |
Čištění | Antigen affinity purification |
Sekvence | PLENSEIPMIPGAHPKGSVGSEPQAFDVFPENPRADSHRNSDVRHAPAEEMPEKPVASPLGPALYGPKAAQGAQRERLPVTDDLQMAQGPSSH |
Skladovací pufr | PBS, pH 7,5 (40% glycerol, 0,02% sodium azide) |
Skladovací teplota | Store at 4 °C. For long term storage store at – 20 °C. Aliquot to avoid repeated freezing and thawing. |