Nechat relaci otevřenou?
Ukončení za 
Relace skončila
Vaše relace vypršela. Pro vaši bezpečnost jsme vás odhlásili.
Chcete se opět přihlásit?

Anti-PRSS36 Rabbit Polyclonal Antibody

Dodavatel: Abnova
Rabbit polyclonal antibody raised against recombinant PRSS36.

Recommended Dilutions: Immunohistochemistry: 1:10-1:20

Type: Primary
Antigen: PRSS36
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human




 

OBJEDNÁVKA

Rozbalit vše / Zavřít vše
Rozměry protilátky Bal. VWR katalogové číslo Množství
100 μl 100 µl ABNOPAB22704
Generovat čárové kódy Formát popisku čárového kódu : 
Vygenerovat PDF katalog

Produktová specifikace

Symbol antigenu PRSS36
Název antigenu Protease Serine 36
Reaktivita Human
Spojení Unconjugated
Klonovalita Polyclonal
Druh protilátky Primary
Hostitel Rabbit
Isotyp IgG
Imunochemie Yes
Identifikační číslo genu 146547
Formát Liquid
Křížová adsorbce No
Imunogen Recombinant protein corresponding to amino acids of human PRSS36.
Čištění Antigen affinity purification
Sekvence WVLGWKEPQDRVPVAAAVSILTQRICDCLYQGILPPGTLCVLYAEGQENRCEMTSAPPLLCQMTEGSWIPVGMAVQGSRELFAAIG
Skladovací pufr PBS, pH 7,5 (40% glycerol, 0,02% sodium azide)
Skladovací teplota Store at 4 °C. For long term storage store at – 20 °C. Aliquot to avoid repeated freezing and thawing.
Enter Details

Select the article for which you are looking for Certificate

Doplňte Lot číslo. Toto pole je povinné. Jestli číslo neznáte, napíšte "x".

Enter Certificate Details

Enter the Lot number:

Choose from recent batch/lot numbers:

Nebo
Review & Compare Alternatives
We found alternative products that can save you up to  per item-unit.  To compare product details, select up to 3 alternatives below and click Compare Selected. To add items to your basket, enter a quantity and click Add to Basket.

Original Product:

Popis Katalogové číslo Availability Jednotka Vaše cena Price Per Množství
 

A new look and a renewed commitment

Built on the features & resources you know, optimized with innovation from Avantor®. Our new brand symbolizes agility and our ability to adapt to customer needs.

Learn More Start Shopping